PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_E3BF20F0D.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 148aa    MW: 16767.1 Da    PI: 9.9085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_E3BF20F0D.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.73e-191461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+lv++++ +G g+W++++r  g+ R++k+c++rw +yl
  Traes_3AL_E3BF20F0D.2 14 RGLWSPEEDEKLVKYITAHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
                           789*******************************************97 PP

2Myb_DNA-binding56.66.1e-1867110146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++++eE+ l+vd+++ lG++ W+ Ia++++ gRt++++k++w++
  Traes_3AL_E3BF20F0D.2  67 RGSFSQEEEALIVDLHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                            89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.594961IPR017930Myb domain
SuperFamilySSF466895.24E-3012108IPR009057Homeodomain-like
SMARTSM007177.3E-131363IPR001005SANT/Myb domain
PfamPF002493.7E-161461IPR001005SANT/Myb domain
CDDcd001673.20E-111761No hitNo description
PROSITE profilePS5129426.81162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.1E-2765117IPR009057Homeodomain-like
SMARTSM007179.8E-1766114IPR001005SANT/Myb domain
PfamPF002496.7E-1667110IPR001005SANT/Myb domain
CDDcd001674.79E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT AHGHGCWSSV PRQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQEEEALIVD LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHYGNIP SSADLYYNIL DGAGQGIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3729260.0AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969713.11e-98PREDICTED: myb-related protein Hv1-like isoform X1
SwissprotQ9SPG31e-73MYB26_ARATH; Transcription factor MYB26
TrEMBLW5CHJ01e-108W5CHJ0_WHEAT; Uncharacterized protein
STRINGMLOC_18177.21e-105(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.23e-78myb domain protein 26
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]